Lineage for d1moxb2 (1mox B:312-480)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1353403Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1353461Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1353531Family c.10.2.5: L domain [52071] (6 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 1353532Protein EGF receptor extracellular domain [82326] (1 species)
  7. 1353533Species Human (Homo sapiens) [TaxId:9606] [82327] (7 PDB entries)
  8. 1353548Domain d1moxb2: 1mox B:312-480 [91377]
    Other proteins in same PDB: d1moxa3, d1moxa4, d1moxb3, d1moxb4, d1moxc_, d1moxd_
    complexed with TGF-alpha
    complexed with cd, cl, nag, pt

Details for d1moxb2

PDB Entry: 1mox (more details), 2.5 Å

PDB Description: crystal structure of human epidermal growth factor receptor (residues 1-501) in complex with tgf-alpha
PDB Compounds: (B:) Epidermal growth factor receptor

SCOPe Domain Sequences for d1moxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1moxb2 c.10.2.5 (B:312-480) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
vcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldil
ktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrslke
isdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq

SCOPe Domain Coordinates for d1moxb2:

Click to download the PDB-style file with coordinates for d1moxb2.
(The format of our PDB-style files is described here.)

Timeline for d1moxb2: