Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.5: L domain [52071] (6 proteins) this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain |
Protein EGF receptor extracellular domain [82326] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82327] (7 PDB entries) |
Domain d1moxa1: 1mox A:1-162 [91372] Other proteins in same PDB: d1moxa3, d1moxa4, d1moxb3, d1moxb4, d1moxc_, d1moxd_ complexed with TGF-alpha complexed with cd, cl, nag, pt |
PDB Entry: 1mox (more details), 2.5 Å
SCOPe Domain Sequences for d1moxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1moxa1 c.10.2.5 (A:1-162) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} leekkvcqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqe vagyvlialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmrnlqeil hgavrfsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgs
Timeline for d1moxa1: