Lineage for d1mexh1 (1mex H:1-113)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652563Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)
  8. 652565Domain d1mexh1: 1mex H:1-113 [91257]
    Other proteins in same PDB: d1mexh2, d1mexl1, d1mexl2
    part of Fab 29g12
    complexed with rac

Details for d1mexh1

PDB Entry: 1mex (more details), 1.25 Å

PDB Description: Antibody Catalysis of a Bimolecular Cycloaddition Reaction
PDB Compounds: (H:) Fab 29G12 heavy chain

SCOP Domain Sequences for d1mexh1:

Sequence, based on SEQRES records: (download)

>d1mexh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqsdaelvkpgasvkisckasgytftdhaihwvkqkpeqglewigyispgngdiky
nekfkgkatltadkssstaymqlnsltsedsavyfckmeyldywgqgttltvss

Sequence, based on observed residues (ATOM records): (download)

>d1mexh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqsdaelvkpgasvkisckasgytftdhaihwvkqkpglewigyispgngdikyne
kfkgkatltadkssstaymqlnsltsedsavyfckmeyldywgqgttltvss

SCOP Domain Coordinates for d1mexh1:

Click to download the PDB-style file with coordinates for d1mexh1.
(The format of our PDB-style files is described here.)

Timeline for d1mexh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mexh2