SCOP 1.71: Domain d1mexh1: 1mex H:1-113

Lineage for d1mexh1 (1mex H:1-113)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1mexh1: 1mex H:1-113 [91257]
   Other proteins in same PDB: d1mexh2, d1mexl1, d1mexl2
   part of Fab 29g12
   complexed with rac

Details for d1mexh1

PDB Entry: 1mex, 1.25 Å

PDB Description: Antibody Catalysis of a Bimolecular Cycloaddition Reaction

SCOP Domain Sequences for d1mexh1:

Sequence, based on SEQRES records:

>d1mexh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqqsdaelvkpgasvkisckasgytftdhaihwvkqkpeqglewigyispgngdiky
nekfkgkatltadkssstaymqlnsltsedsavyfckmeyldywgqgttltvss

Sequence, based on observed residues (ATOM records):

>d1mexh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqqsdaelvkpgasvkisckasgytftdhaihwvkqkpglewigyispgngdikyne
kfkgkatltadkssstaymqlnsltsedsavyfckmeyldywgqgttltvss

Timeline for d1mexh1:

• d1mexh1 first appeared in SCOP 1.67
  
• d1mexh1 appears in SCOP 1.69
  
• d1mexh1 appears in SCOP 1.73
  
• d1mexh1 appears in the current release, SCOPe 2.08