SCOP 1.73: Domain d1mexl1: 1mex L:1-107

Lineage for d1mexl1 (1mex L:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d1mexl1: 1mex L:1-107 [91259]
   Other proteins in same PDB: d1mexh1, d1mexh2, d1mexl2
   part of Fab 29g12
   complexed with rac

Details for d1mexl1

PDB Entry: 1mex, 1.25 Å

PDB Description: Antibody Catalysis of a Bimolecular Cycloaddition Reaction

PDB Compounds: (L:) Fab 29G12 light chain

SCOP Domain Sequences for d1mexl1:

Sequence; same for both SEQRES and ATOM records:

>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
divmtqsqkfmstslgnrvsvtckasqnvgtnvawfqqkpgqspktliysasyrysgvpd
rftgsgsgtdftltinnvqsedlaeyfcqqynsypytfgggtkleik

Timeline for d1mexl1:

• d1mexl1 first appeared in SCOP 1.67
  
• d1mexl1 appears in SCOP 1.71
  
• d1mexl1 appears in SCOP 1.75
  
• d1mexl1 appears in the current release, SCOPe 2.08