Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein Dihydroorotate dehydrogenase [51397] (8 species) |
Species Lactococcus lactis, isozyme A [TaxId:1358] [51398] (9 PDB entries) |
Domain d1jueb_: 1jue B: [90911] complexed with acy, fmn, gol, mg has additional subdomain(s) that are not in the common domain has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1jue (more details), 1.8 Å
SCOPe Domain Sequences for d1jueb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jueb_ c.1.4.1 (B:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs iadfhgklksl
Timeline for d1jueb_: