Lineage for d1j4zb3 (1j4z B:137-190,B:367-409)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603057Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 603058Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 603059Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 603060Protein GroEL, I domain [54851] (4 species)
  7. 603061Species Escherichia coli [TaxId:562] [54852] (9 PDB entries)
  8. 603140Domain d1j4zb3: 1j4z B:137-190,B:367-409 [90843]
    Other proteins in same PDB: d1j4za1, d1j4za2, d1j4zb1, d1j4zb2, d1j4zc1, d1j4zc2, d1j4zd1, d1j4zd2, d1j4ze1, d1j4ze2, d1j4zf1, d1j4zf2, d1j4zg1, d1j4zg2, d1j4zh1, d1j4zh2, d1j4zi1, d1j4zi2, d1j4zj1, d1j4zj2, d1j4zk1, d1j4zk2, d1j4zl1, d1j4zl2, d1j4zm1, d1j4zm2, d1j4zn1, d1j4zn2

Details for d1j4zb3

PDB Entry: 1j4z (more details), 3.52 Å

PDB Description: Structural and mechanistic basis for allostery in the bacterial chaperonin GroEL; see remark 400

SCOP Domain Sequences for d1j4zb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j4zb3 d.56.1.1 (B:137-190,B:367-409) GroEL, I domain {Escherichia coli}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarveaalhatraavee

SCOP Domain Coordinates for d1j4zb3:

Click to download the PDB-style file with coordinates for d1j4zb3.
(The format of our PDB-style files is described here.)

Timeline for d1j4zb3: