Lineage for d1j4zb2 (1j4z B:191-366)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577176Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (9 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 577291Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 577292Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
  6. 577293Protein GroEL, A domain [52031] (4 species)
  7. 577294Species Escherichia coli [TaxId:562] [52032] (16 PDB entries)
  8. 577384Domain d1j4zb2: 1j4z B:191-366 [90842]
    Other proteins in same PDB: d1j4za1, d1j4za3, d1j4zb1, d1j4zb3, d1j4zc1, d1j4zc3, d1j4zd1, d1j4zd3, d1j4ze1, d1j4ze3, d1j4zf1, d1j4zf3, d1j4zg1, d1j4zg3, d1j4zh1, d1j4zh3, d1j4zi1, d1j4zi3, d1j4zj1, d1j4zj3, d1j4zk1, d1j4zk3, d1j4zl1, d1j4zl3, d1j4zm1, d1j4zm3, d1j4zn1, d1j4zn3

Details for d1j4zb2

PDB Entry: 1j4z (more details), 3.52 Å

PDB Description: Structural and mechanistic basis for allostery in the bacterial chaperonin GroEL; see remark 400

SCOP Domain Sequences for d1j4zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j4zb2 c.8.5.1 (B:191-366) GroEL, A domain {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOP Domain Coordinates for d1j4zb2:

Click to download the PDB-style file with coordinates for d1j4zb2.
(The format of our PDB-style files is described here.)

Timeline for d1j4zb2: