SCOPe 2.02: Domain d1ista_: 1ist A:

Lineage for d1ista_ (1ist A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), variant A [TaxId:4932] [101878] (1 PDB entry)

8. Domain d1ista_: 1ist A: [90692]

Details for d1ista_

PDB Entry: 1ist, 1.9 Å

PDB Description: crystal structure of yeast cyclophilin a, cpr1

PDB Compounds: (A:) cyclophilin a

SCOPe Domain Sequences for d1ista_:

Sequence; same for both SEQRES and ATOM records:

>d1ista_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Baker's yeast (Saccharomyces cerevisiae), variant A [TaxId: 4932]}
sqvyfdveadgqpigrvvfklyndivpktaenfralctgekgfgyagspfhrvipdfmlq
ggdftagngtggksiyggkfpdenfkkhhdrpgllsmanagpntngsqffittvpcpwld
gkhvvfgevvdgydivkkveslgspsgatkarivvaksgel

Timeline for d1ista_:

• d1ista_ first appeared in SCOP 1.67
  
• d1ista_ appears in SCOPe 2.01
  
• d1ista_ appears in SCOPe 2.03
  
• d1ista_ appears in the current release, SCOPe 2.08