SCOPe 2.05: Domain d1h2bb1: 1h2b B:16-154,B:327-359

Lineage for d1h2bb1 (1h2b B:16-154,B:327-359)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Aeropyrum pernix [TaxId:56636] [101701] (1 PDB entry)

8. Domain d1h2bb1: 1h2b B:16-154,B:327-359 [90545]
   Other proteins in same PDB: d1h2ba2, d1h2bb2
   complexed with naj, oca, zn

Details for d1h2bb1

PDB Entry: 1h2b, 1.62 Å

PDB Description: crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution

PDB Compounds: (B:) alcohol dehydrogenase

SCOPe Domain Sequences for d1h2bb1:

Sequence; same for both SEQRES and ATOM records:

>d1h2bb1 b.35.1.2 (B:16-154,B:327-359) Alcohol dehydrogenase {Aeropyrum pernix [TaxId: 56636]}
lkaarlheynkplriedvdyprlegrfdvivriagagvchtdlhlvqgmwhellqpklpy
tlghenvgyieevaegveglekgdpvilhpavtdgtclacragedmhcenlefpglnidg
gfaefmrtshrsviklpkdXvrvevdihkldeindvlerlekgevlgravlip

Timeline for d1h2bb1:

• d1h2bb1 first appeared in SCOP 1.67
  
• d1h2bb1 appears in SCOPe 2.04
  
• d1h2bb1 appears in SCOPe 2.06
  
• d1h2bb1 appears in the current release, SCOPe 2.08