Lineage for d1f9qc_ (1f9q C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175338Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2175339Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2175340Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2175517Protein Platelet factor 4, PF4 [54121] (2 species)
  7. 2175523Species Human (Homo sapiens) [TaxId:9606] [54123] (6 PDB entries)
  8. 2175530Domain d1f9qc_: 1f9q C: [90482]

Details for d1f9qc_

PDB Entry: 1f9q (more details), 2 Å

PDB Description: crystal structure of platelet factor 4
PDB Compounds: (C:) platelet factor 4

SCOPe Domain Sequences for d1f9qc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9qc_ d.9.1.1 (C:) Platelet factor 4, PF4 {Human (Homo sapiens) [TaxId: 9606]}
qclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaplykkiikkll
es

SCOPe Domain Coordinates for d1f9qc_:

Click to download the PDB-style file with coordinates for d1f9qc_.
(The format of our PDB-style files is described here.)

Timeline for d1f9qc_: