SCOPe 2.05: Domain d1ejwc1: 1ejw C:1002-1129,C:1423-1475

Lineage for d1ejwc1 (1ejw C:1002-1129,C:1423-1475)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)

6. Protein alpha-Subunit of urease [51340] (4 species)

7. Species Klebsiella aerogenes [TaxId:28451] [51341] (27 PDB entries)

8. Domain d1ejwc1: 1ejw C:1002-1129,C:1423-1475 [90455]
   Other proteins in same PDB: d1ejwa_, d1ejwb_, d1ejwc2
   complexed with ni

Details for d1ejwc1

PDB Entry: 1ejw, 1.9 Å

PDB Description: crystal structure of wild-type klebsiella aerogenes urease at 298k

PDB Compounds: (C:) urease alpha subunit

SCOPe Domain Sequences for d1ejwc1:

Sequence; same for both SEQRES and ATOM records:

>d1ejwc1 b.92.1.1 (C:1002-1129,C:1423-1475) alpha-Subunit of urease {Klebsiella aerogenes [TaxId: 28451]}
snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
egkivtagXsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy
rp

Timeline for d1ejwc1:

• d1ejwc1 first appeared in SCOP 1.67
  
• d1ejwc1 appears in SCOPe 2.04
  
• d1ejwc1 appears in SCOPe 2.06
  
• d1ejwc1 appears in the current release, SCOPe 2.08