Lineage for d1b5pa_ (1b5p A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1866062Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 1866122Protein Aspartate aminotransferase, AAT [53385] (8 species)
  7. 1866271Species Thermus thermophilus [TaxId:274] [53391] (9 PDB entries)
  8. 1866272Domain d1b5pa_: 1b5p A: [90403]
    complexed with plp, po4; mutant

Details for d1b5pa_

PDB Entry: 1b5p (more details), 1.8 Å

PDB Description: thermus thermophilus aspartate aminotransferase double mutant 1
PDB Compounds: (A:) protein (aspartate aminotransferase)

SCOPe Domain Sequences for d1b5pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]}
mrglsrrvqamkpsatvavnakalelrrqgvdlvaltagepdfdtpehvkeaarralaqg
ktkyappagipelrealaekfrrenglsvtpeetivtvggsqalfnlfqaildpgdeviv
lspywvsypemvrfaggvvvevetlpeegfvpdpervrraitprtkalvvnspnnptgav
ypkevlealarlavehdfylvsdeiyehllyegehfspgrvapehtltvngaakafamtg
wrigyacgpkevikamasvsrqsttspdtiaqwatlealtnqeasrafvemareayrrrr
dlllegltalglkavrpsgafyvlmdtspiapdevraaerlleagvavvpgtdfaafghv
rlsyatseenlrkalerfarvl

SCOPe Domain Coordinates for d1b5pa_:

Click to download the PDB-style file with coordinates for d1b5pa_.
(The format of our PDB-style files is described here.)

Timeline for d1b5pa_: