Lineage for d1qcbg_ (1qcb G:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 949388Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 949389Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 949513Protein Heat-labile toxin [50205] (2 species)
  7. 949650Species Escherichia coli, type IIB [TaxId:562] [50207] (3 PDB entries)
  8. 949664Domain d1qcbg_: 1qcb G: [88365]

Details for d1qcbg_

PDB Entry: 1qcb (more details), 2.2 Å

PDB Description: escherichia coli heat labile enterotoxin type iib b-pentamer
PDB Compounds: (G:) protein (heat labile enterotoxin type iib b-pentamer)

SCOPe Domain Sequences for d1qcbg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcbg_ b.40.2.1 (G:) Heat-labile toxin {Escherichia coli, type IIB [TaxId: 562]}
gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
taemrkiamaavlsgmrvnmcaspasspnviwaieleae

SCOPe Domain Coordinates for d1qcbg_:

Click to download the PDB-style file with coordinates for d1qcbg_.
(The format of our PDB-style files is described here.)

Timeline for d1qcbg_: