Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
Protein 70S ribosome functional complex [58121] (4 species) |
Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
Domain d1pnyx_: 1pny X: [88274] Other proteins in same PDB: d1pny52 50S subunit; the coordinates of 30S subunit in 1pnx protein/RNA complex protein/RNA complex |
PDB Entry: 1pny (more details), 9.5 Å
SCOPe Domain Sequences for d1pnyx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pnyx_ i.1.1.1 (X:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} mkiklvrsvigrpgnqvktvqalglrkigdsrevsdtpavrgmvktvkhllevqe
Timeline for d1pnyx_:
View in 3D Domains from other chains: (mouse over for more information) d1pny1_, d1pny2_, d1pny3_, d1pny4_, d1pny51, d1pny52, d1pnya_, d1pnyb_, d1pnyc_, d1pnyd_, d1pnye_, d1pnyf_, d1pnyg_, d1pnyh_, d1pnyi_, d1pnyj_, d1pnyk_, d1pnyl_, d1pnym_, d1pnyn_, d1pnyo_, d1pnyp_, d1pnyq_, d1pnyr_, d1pnys_, d1pnyt_, d1pnyu_, d1pnyv_, d1pnyw_, d1pnyy_, d1pnyz_ |