Lineage for d1pkqg2 (1pkq G:114-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760578Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1760582Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 1760837Domain d1pkqg2: 1pkq G:114-213 [88156]
    Other proteins in same PDB: d1pkqa1, d1pkqa2, d1pkqb1, d1pkqe_, d1pkqf1, d1pkqf2, d1pkqg1, d1pkqj_
    part of humanized Fab 8-18c5

Details for d1pkqg2

PDB Entry: 1pkq (more details), 3 Å

PDB Description: Myelin Oligodendrocyte Glycoprotein-(8-18C5) Fab-complex
PDB Compounds: (G:) (8-18C5) chimeric Fab, heavy chain

SCOPe Domain Sequences for d1pkqg2:

Sequence, based on SEQRES records: (download)

>d1pkqg2 b.1.1.2 (G:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d1pkqg2 b.1.1.2 (G:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d1pkqg2:

Click to download the PDB-style file with coordinates for d1pkqg2.
(The format of our PDB-style files is described here.)

Timeline for d1pkqg2: