Lineage for d1ph7a3 (1ph7 A:329-495)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124702Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 1124845Protein Telomere end binding protein alpha subunit [50273] (1 species)
    duplication: consists of three domains of this fold
  7. 1124846Species Oxytricha nova [TaxId:200597] [50274] (16 PDB entries)
  8. 1124891Domain d1ph7a3: 1ph7 A:329-495 [88101]
    Other proteins in same PDB: d1ph7b_
    protein/DNA complex; complexed with cl, na

Details for d1ph7a3

PDB Entry: 1ph7 (more details), 2.9 Å

PDB Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna ggggttttgigg
PDB Compounds: (A:) Telomere-binding protein alpha subunit

SCOPe Domain Sequences for d1ph7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ph7a3 b.40.4.3 (A:329-495) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]}
slnavvltevdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvk
gydrktkkssslkgasgkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvka
dnlhknadarkkledsaelltkfnsyvdavverrngfylikdtkliy

SCOPe Domain Coordinates for d1ph7a3:

Click to download the PDB-style file with coordinates for d1ph7a3.
(The format of our PDB-style files is described here.)

Timeline for d1ph7a3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ph7b_