![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins) |
![]() | Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (5 species) contains an extra alpha-helical domain |
![]() | Species Transmissible gastroenteritis virus [TaxId:11149] [74980] (3 PDB entries) |
![]() | Domain d1p9ud_: 1p9u D: [88004] complexed with mrd, so4 |
PDB Entry: 1p9u (more details), 2.37 Å
SCOPe Domain Sequences for d1p9ud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p9ud_ b.47.1.4 (D:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Transmissible gastroenteritis virus [TaxId: 11149]} sglrkmaqpsglvepcivrvsygnnvlnglwlgdevicprhviasdttrvinyenemssv rlhnfsvsknnvflgvvsarykgvnlvlkvnqvnpntpehkfksikagesfnilacyegc pgsvygvnmrsqgtikgsfiagtcgsvgyvlengilyfvymhhlelgngshvgsnfegem yggyedqpsmqlegtnvmssdnvvaflyaalingerwfvtntsmslesyntwaktnsfte lsstdafsmlaaktgqsveklldsivrlnkgfggrtilsygslcdeftptevirqmygvn l
Timeline for d1p9ud_: