Lineage for d1p5vb_ (1p5v B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1771869Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1771874Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1771875Protein F1 capsule antigen Caf1 [89213] (1 species)
  7. 1771876Species Yersinia pestis [TaxId:632] [89214] (6 PDB entries)
  8. 1771877Domain d1p5vb_: 1p5v B: [87814]
    Other proteins in same PDB: d1p5va1, d1p5va2

Details for d1p5vb_

PDB Entry: 1p5v (more details), 1.7 Å

PDB Description: x-ray structure of the caf1m:caf1 chaperone:subunit preassembly complex
PDB Compounds: (B:) F1 capsule antigen

SCOPe Domain Sequences for d1p5vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p5vb_ b.2.3.2 (B:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
veparitltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmylt
ftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggkl
aagkytdavtvtvsnq

SCOPe Domain Coordinates for d1p5vb_:

Click to download the PDB-style file with coordinates for d1p5vb_.
(The format of our PDB-style files is described here.)

Timeline for d1p5vb_: