SCOPe 2.04: Domain d1p22b2: 1p22 B:2-59

Lineage for d1p22b2 (1p22 B:2-59)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54711] (9 PDB entries)

8. Domain d1p22b2: 1p22 B:2-59 [87718]
   Other proteins in same PDB: d1p22a1, d1p22a2, d1p22b1

Details for d1p22b2

PDB Entry: 1p22, 2.95 Å

PDB Description: Structure of a beta-TrCP1-Skp1-beta-catenin complex: destruction motif binding and lysine specificity on the SCFbeta-TrCP1 ubiquitin ligase

PDB Compounds: (B:) skp1

SCOPe Domain Sequences for d1p22b2:

Sequence; same for both SEQRES and ATOM records:

>d1p22b2 d.42.1.1 (B:2-59) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthh

Timeline for d1p22b2:

• d1p22b2 first appeared in SCOP 1.65
  
• d1p22b2 appears in SCOPe 2.03
  
• d1p22b2 appears in SCOPe 2.05
  
• d1p22b2 appears in the current release, SCOPe 2.08