![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
![]() | Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54711] (9 PDB entries) |
![]() | Domain d1p22b2: 1p22 B:2-59 [87718] Other proteins in same PDB: d1p22a1, d1p22a2, d1p22a3, d1p22b1 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1p22 (more details), 2.95 Å
SCOPe Domain Sequences for d1p22b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p22b2 d.42.1.1 (B:2-59) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthh
Timeline for d1p22b2: