Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (5 families) has a circularly permuted topology |
Family d.142.2.3: mRNA capping enzyme [56100] (2 proteins) automatically mapped to Pfam PF01331 |
Protein mRNA capping enzyme alpha subunit [90032] (1 species) |
Species Yeast (Candida albicans) [TaxId:5476] [90033] (1 PDB entry) |
Domain d1p16b2: 1p16 B:1-245 [87664] Other proteins in same PDB: d1p16a1, d1p16b1 complexed with the phosphorylated carboxyl-terminal peptide of RNA polymerase II, chains C and D complexed with g, gtp, po4 |
PDB Entry: 1p16 (more details), 2.7 Å
SCOPe Domain Sequences for d1p16b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p16b2 d.142.2.3 (B:1-245) mRNA capping enzyme alpha subunit {Yeast (Candida albicans) [TaxId: 5476]} mvqleereipvipgnkldeeetkelrlmvaellgrrntgfpgsqpvsferrhleetlmqk dyfvcektdglrcllflindpdkgegvflvtrendyyfipnihfplsvnetrekptyhhg tlldgelvlenrnvsepvlryvifdalaihgkciidrplpkrlgyitenvmkpfdnfkkh npdivnspefpfkvgfktmltsyhaddvlskmdklfhasdgliytcaetpyvfgtdqtll kwkpa
Timeline for d1p16b2: