![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (3 families) ![]() has a circularly permuted topology |
![]() | Family d.142.2.3: mRNA capping enzyme [56100] (2 proteins) |
![]() | Protein mRNA capping enzyme alpha subunit [90032] (1 species) |
![]() | Species Yeast (Candida albicans) [TaxId:5476] [90033] (1 PDB entry) |
![]() | Domain d1p16b2: 1p16 B:1-245 [87664] Other proteins in same PDB: d1p16a1, d1p16b1 complexed with the phosphorylated carboxyl-terminal peptide of RNA polymerase II, chains C and D complexed with g, gtp, mse, po4, sep; mutant |
PDB Entry: 1p16 (more details), 2.7 Å
SCOP Domain Sequences for d1p16b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p16b2 d.142.2.3 (B:1-245) mRNA capping enzyme alpha subunit {Yeast (Candida albicans)} mvqleereipvipgnkldeeetkelrlmvaellgrrntgfpgsqpvsferrhleetlmqk dyfvcektdglrcllflindpdkgegvflvtrendyyfipnihfplsvnetrekptyhhg tlldgelvlenrnvsepvlryvifdalaihgkciidrplpkrlgyitenvmkpfdnfkkh npdivnspefpfkvgfktmltsyhaddvlskmdklfhasdgliytcaetpyvfgtdqtll kwkpa
Timeline for d1p16b2: