Lineage for d1p16a1 (1p16 A:246-390)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399815Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins)
  6. 2399830Protein mRNA capping enzyme alpha subunit [89330] (1 species)
  7. 2399831Species Yeast (Candida albicans) [TaxId:5476] [89331] (1 PDB entry)
  8. 2399832Domain d1p16a1: 1p16 A:246-390 [87661]
    Other proteins in same PDB: d1p16a2, d1p16a3, d1p16b2, d1p16b3
    complexed with the phosphorylated carboxyl-terminal peptide of RNA polymerase II, chains C and D
    complexed with g, gtp, po4

Details for d1p16a1

PDB Entry: 1p16 (more details), 2.7 Å

PDB Description: structure of an mrna capping enzyme bound to the phosphorylated carboxyl-terminal domain of rna polymerase ii
PDB Compounds: (A:) mRNA capping enzyme alpha subunit

SCOPe Domain Sequences for d1p16a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p16a1 b.40.4.6 (A:246-390) mRNA capping enzyme alpha subunit {Yeast (Candida albicans) [TaxId: 5476]}
eentvdfqlefvfnevqdpdlderdptstyldydakpnliklrvwqgsnvhtdfakldls
dddwerlkaleqplqgriaecrqsttkkgywemlrfrndksngnhisvvekilvsikdgv
kekeviewcpkisrawkkrendrrq

SCOPe Domain Coordinates for d1p16a1:

Click to download the PDB-style file with coordinates for d1p16a1.
(The format of our PDB-style files is described here.)

Timeline for d1p16a1: