![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins) |
![]() | Protein mRNA capping enzyme alpha subunit [89330] (1 species) |
![]() | Species Yeast (Candida albicans) [TaxId:5476] [89331] (1 PDB entry) |
![]() | Domain d1p16a1: 1p16 A:246-390 [87661] Other proteins in same PDB: d1p16a2, d1p16a3, d1p16b2, d1p16b3 complexed with the phosphorylated carboxyl-terminal peptide of RNA polymerase II, chains C and D complexed with g, gtp, po4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1p16 (more details), 2.7 Å
SCOPe Domain Sequences for d1p16a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p16a1 b.40.4.6 (A:246-390) mRNA capping enzyme alpha subunit {Yeast (Candida albicans) [TaxId: 5476]} eentvdfqlefvfnevqdpdlderdptstyldydakpnliklrvwqgsnvhtdfakldls dddwerlkaleqplqgriaecrqsttkkgywemlrfrndksngnhisvvekilvsikdgv kekeviewcpkisrawkkrendrrq
Timeline for d1p16a1: