SCOPe 2.08: Domain d1p16a1: 1p16 A:246-390

Lineage for d1p16a1 (1p16 A:246-390)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins)

6. Protein mRNA capping enzyme alpha subunit [89330] (1 species)

7. Species Yeast (Candida albicans) [TaxId:5476] [89331] (1 PDB entry)

8. Domain d1p16a1: 1p16 A:246-390 [87661]
   Other proteins in same PDB: d1p16a2, d1p16a3, d1p16b2, d1p16b3
   complexed with the phosphorylated carboxyl-terminal peptide of RNA polymerase II, chains C and D
   complexed with g, gtp, po4
   has additional insertions and/or extensions that are not grouped together

Details for d1p16a1

PDB Entry: 1p16, 2.7 Å

PDB Description: Structure of an mRNA capping enzyme bound to the phosphorylated carboxyl-terminal domain of RNA polymerase II

PDB Compounds: (A:) mRNA capping enzyme alpha subunit

SCOPe Domain Sequences for d1p16a1:

Sequence; same for both SEQRES and ATOM records:

>d1p16a1 b.40.4.6 (A:246-390) mRNA capping enzyme alpha subunit {Yeast (Candida albicans) [TaxId: 5476]}
eentvdfqlefvfnevqdpdlderdptstyldydakpnliklrvwqgsnvhtdfakldls
dddwerlkaleqplqgriaecrqsttkkgywemlrfrndksngnhisvvekilvsikdgv
kekeviewcpkisrawkkrendrrq

Timeline for d1p16a1:

• d1p16a1 first appeared in SCOP 1.65
  
• d1p16a1 appears in SCOPe 2.07