Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class tau GST [81354] (2 species) |
Species Rice (Oryza sativa) [TaxId:4530] [89062] (1 PDB entry) |
Domain d1oyja1: 1oyj A:86-230 [87597] Other proteins in same PDB: d1oyja2, d1oyjb2, d1oyjc2, d1oyjd2 complexed with cl, gol, gsh, mg |
PDB Entry: 1oyj (more details), 1.95 Å
SCOPe Domain Sequences for d1oyja1:
Sequence, based on SEQRES records: (download)
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} llppansgdadaayaratarfwadyvdrklydcgsrlwrlkgepqaaagremaeilrtle aelgdreffggggggrlgfvdvalvpftawfysyercggfsveevaprlaawarrcgrid svvkhlpspekvydfvgvlkkkygv
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} llppansgadaayaratarfwadyvdrklydcgsrlwrlkgepqaaagremaeilrtlea elgdreffggggggrlgfvdvalvpftawfysyercggfsveevaprlaawarrcgrids vvkhlpspekvydfvgvlkkkygv
Timeline for d1oyja1: