Lineage for d1oy9a7 (1oy9 A:7-37,A:331-498)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028170Fold f.35: Multidrug efflux transporter AcrB transmembrane domain [82865] (1 superfamily)
    12 transmembrane helices; duplication: the N- and C-terminal halves of the whole proteins are structurally similar
  4. 3028171Superfamily f.35.1: Multidrug efflux transporter AcrB transmembrane domain [82866] (1 family) (S)
  5. 3028172Family f.35.1.1: Multidrug efflux transporter AcrB transmembrane domain [82867] (1 protein)
  6. 3028173Protein Multidrug efflux transporter AcrB transmembrane domain [82868] (1 species)
  7. 3028174Species Escherichia coli [TaxId:562] [82869] (7 PDB entries)
  8. 3028189Domain d1oy9a7: 1oy9 A:7-37,A:331-498 [87577]
    Other proteins in same PDB: d1oy9a1, d1oy9a2, d1oy9a3, d1oy9a4, d1oy9a5, d1oy9a6
    complexed with et

Details for d1oy9a7

PDB Entry: 1oy9 (more details), 3.8 Å

PDB Description: Structural Basis of Multiple Drug Binding Capacity of the AcrB Multidrug Efflux Pump
PDB Compounds: (A:) Acriflavine resistance protein B

SCOPe Domain Sequences for d1oy9a7:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oy9a7 f.35.1.1 (A:7-37,A:331-498) Multidrug efflux transporter AcrB transmembrane domain {Escherichia coli [TaxId: 562]}
drpifawviaiiimlagglailklpvaqyptXpfvkisihevvktlveaiilvflvmylf
lqnfratliptiavpvvllgtfavlaafgfsintltmfgmvlaigllvddaivvvenver
vmaeeglppkeatrksmgqiqgalvgiamvlsavfvpmaffggstgaiyrqfsitivsam
alsvlvaliltpalcatmlk

SCOPe Domain Coordinates for d1oy9a7:

Click to download the PDB-style file with coordinates for d1oy9a7.
(The format of our PDB-style files is described here.)

Timeline for d1oy9a7: