Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.35: Multidrug efflux transporter AcrB transmembrane domain [82865] (1 superfamily) 12 transmembrane helices; duplication: the N- and C-terminal halves of the whole proteins are structurally similar |
Superfamily f.35.1: Multidrug efflux transporter AcrB transmembrane domain [82866] (1 family) |
Family f.35.1.1: Multidrug efflux transporter AcrB transmembrane domain [82867] (1 protein) |
Protein Multidrug efflux transporter AcrB transmembrane domain [82868] (1 species) |
Species Escherichia coli [TaxId:562] [82869] (7 PDB entries) |
Domain d1oy6a8: 1oy6 A:513-566,A:869-1036 [87562] Other proteins in same PDB: d1oy6a1, d1oy6a2, d1oy6a3, d1oy6a4, d1oy6a5, d1oy6a6 |
PDB Entry: 1oy6 (more details), 3.68 Å
SCOPe Domain Sequences for d1oy6a8:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oy6a8 f.35.1.1 (A:513-566,A:869-1036) Multidrug efflux transporter AcrB transmembrane domain {Escherichia coli [TaxId: 562]} fgwfnrmfeksthhytdsvggilrstgrylvlyliivvgmaylfvrlpssflpdXsgnqa pslyaislivvflclaalyeswsipfsvmlvvplgvigallaatfrgltndvyfqvgllt tiglsaknailivefakdlmdkegkglieatldavrmrlrpilmtslafilgvmplvist gagsgaqnavgtgvmggmvtatvlaiffvpvffvvvrrrfsrk
Timeline for d1oy6a8: