Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId:4932] [69449] (4 PDB entries) |
Domain d1ox5a2: 1ox5 A:-3-229 [87502] Other proteins in same PDB: d1ox5a1, d1ox5b1 complexed with 1pr, ni |
PDB Entry: 1ox5 (more details), 2.5 Å
SCOPe Domain Sequences for d1ox5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ox5a2 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} gshmpvvhvidvesgnlqsltnaiehlgyevqlvkspkdfnisgtsrlilpgvgnyghfv dnlfnrgfekpireyiesgkpimgicvglqalfagsvespkstglnyidfklsrfddsek pvpeigwnscipsenlffgldpykryyfvhsfaailnsekkknlendgwkiakakygsee fiaavnknnifatqfhpeksgkaglnvienflkqqsppipnysaeekellmn
Timeline for d1ox5a2: