SCOPe 2.02: Domain d1ox5a2: 1ox5 A:-3-229

Lineage for d1ox5a2 (1ox5 A:-3-229)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId:4932] [69449] (4 PDB entries)

8. Domain d1ox5a2: 1ox5 A:-3-229 [87502]
   Other proteins in same PDB: d1ox5a1, d1ox5b1
   complexed with 1pr, ni

Details for d1ox5a2

PDB Entry: 1ox5, 2.5 Å

PDB Description: towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase

PDB Compounds: (A:) Imidazole glycerol phosphate synthase hisHF

SCOPe Domain Sequences for d1ox5a2:

Sequence; same for both SEQRES and ATOM records:

>d1ox5a2 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]}
gshmpvvhvidvesgnlqsltnaiehlgyevqlvkspkdfnisgtsrlilpgvgnyghfv
dnlfnrgfekpireyiesgkpimgicvglqalfagsvespkstglnyidfklsrfddsek
pvpeigwnscipsenlffgldpykryyfvhsfaailnsekkknlendgwkiakakygsee
fiaavnknnifatqfhpeksgkaglnvienflkqqsppipnysaeekellmn

Timeline for d1ox5a2:

• d1ox5a2 first appeared in SCOP 1.65
  
• d1ox5a2 appears in SCOPe 2.01
  
• d1ox5a2 appears in SCOPe 2.03
  
• d1ox5a2 appears in the current release, SCOPe 2.08