Lineage for d1otub_ (1otu B:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237763Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 1237764Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 1237765Family f.20.1.1: Clc chloride channel [69912] (1 protein)
    duplication: consist of two similar structural parts
  6. 1237766Protein Clc chloride channel [69913] (2 species)
  7. 1237767Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. 1237805Domain d1otub_: 1otu B: [87436]
    Other proteins in same PDB: d1otuc1, d1otuc2, d1otud1, d1otud2, d1otue1, d1otue2, d1otuf1, d1otuf2
    complexed with cl; mutant

Details for d1otub_

PDB Entry: 1otu (more details), 3.3 Å

PDB Description: structure of the escherichia coli clc chloride channel e148q mutant and fab complex
PDB Compounds: (B:) Voltage-gated ClC-type chloride channel eriC

SCOPe Domain Sequences for d1otub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otub_ f.20.1.1 (B:) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
ftggkplysailartlakqea

SCOPe Domain Coordinates for d1otub_:

Click to download the PDB-style file with coordinates for d1otub_.
(The format of our PDB-style files is described here.)

Timeline for d1otub_: