Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.20: Clc chloride channel [81341] (1 superfamily) core: 18 transmembrane helices |
Superfamily f.20.1: Clc chloride channel [81340] (1 family) |
Family f.20.1.1: Clc chloride channel [69912] (1 protein) duplication: consist of two similar structural parts |
Protein Clc chloride channel [69913] (2 species) |
Species Escherichia coli [TaxId:562] [69914] (9 PDB entries) |
Domain d1otta_: 1ott A: [87425] Other proteins in same PDB: d1ottc1, d1ottc2, d1ottd1, d1ottd2, d1otte1, d1otte2, d1ottf1, d1ottf2 |
PDB Entry: 1ott (more details), 3 Å
SCOP Domain Sequences for d1otta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1otta_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]} rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl gtlgggmvlgragptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla qftggkplysailartlakqeaeq
Timeline for d1otta_: