![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries) |
![]() | Domain d1ottf2: 1ott F:107-211 [87434] Other proteins in same PDB: d1otta_, d1ottb_, d1ottc1, d1ottc2, d1ottd1, d1otte1, d1otte2, d1ottf1 part of anti-CLC chloride channel Fab complexed with cl; mutant |
PDB Entry: 1ott (more details), 3 Å
SCOP Domain Sequences for d1ottf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ottf2 b.1.1.2 (F:107-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnra
Timeline for d1ottf2: