Lineage for d1ottf2 (1ott F:107-211)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656497Domain d1ottf2: 1ott F:107-211 [87434]
    Other proteins in same PDB: d1otta_, d1ottb_, d1ottc1, d1ottc2, d1ottd1, d1otte1, d1otte2, d1ottf1
    part of anti-CLC chloride channel Fab
    complexed with cl; mutant

Details for d1ottf2

PDB Entry: 1ott (more details), 3 Å

PDB Description: structure of the escherichia coli clc chloride channel e148a mutant and fab complex
PDB Compounds: (F:) Fab Fragment (Light Chain)

SCOP Domain Sequences for d1ottf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ottf2 b.1.1.2 (F:107-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

SCOP Domain Coordinates for d1ottf2:

Click to download the PDB-style file with coordinates for d1ottf2.
(The format of our PDB-style files is described here.)

Timeline for d1ottf2: