![]() | Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
![]() | Fold f.20: Clc chloride channel [81341] (1 superfamily) core: 18 transmembrane helices |
![]() | Superfamily f.20.1: Clc chloride channel [81340] (1 family) ![]() |
![]() | Family f.20.1.1: Clc chloride channel [69912] (1 protein) duplication: consist of two similar structural parts |
![]() | Protein Clc chloride channel [69913] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [69914] (9 PDB entries) |
![]() | Domain d1ottb_: 1ott B: [87426] Other proteins in same PDB: d1ottc1, d1ottc2, d1ottd1, d1ottd2, d1otte1, d1otte2, d1ottf1, d1ottf2 complexed with cl; mutant |
PDB Entry: 1ott (more details), 3 Å
SCOP Domain Sequences for d1ottb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ottb_ f.20.1.1 (B:) Clc chloride channel {Escherichia coli [TaxId: 562]} rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg tlgggmvlgragptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq ftggkplysailartlakqea
Timeline for d1ottb_: