![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies) consists of eight 4-stranded beta-sheet motifs; meander also found in some members of the WD40-repeat superfamily |
![]() | Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) ![]() |
![]() | Family b.70.3.1: DPP6 N-terminal domain-like [82172] (2 proteins) Pfam PF00930 |
![]() | Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [89381] (8 PDB entries) |
![]() | Domain d1orwd1: 1orw D:39-508 [87368] Other proteins in same PDB: d1orwa2, d1orwb2, d1orwc2, d1orwd2 complexed with nag, phi, so4 |
PDB Entry: 1orw (more details), 2.84 Å
SCOPe Domain Sequences for d1orwd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orwd1 b.70.3.1 (D:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvq
Timeline for d1orwd1: