Lineage for d1oqdr_ (1oqd R:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2261362Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 2261363Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 2261478Family g.24.1.2: BAFF receptor-like [90174] (4 proteins)
    only fragments of the receptor structures are available; no domain division is provided here
  6. 2261496Protein Tumor necrosis factor receptor superfamily member 17, BCMA [90177] (1 species)
  7. 2261497Species Human (Homo sapiens) [TaxId:9606] [90178] (3 PDB entries)
    Uniprot Q02223 8-43
  8. 2261510Domain d1oqdr_: 1oqd R: [87285]
    Other proteins in same PDB: d1oqda_, d1oqdb_, d1oqdc_, d1oqdd_, d1oqde_, d1oqdf_, d1oqdg_, d1oqdh_, d1oqdi_, d1oqdj_

Details for d1oqdr_

PDB Entry: 1oqd (more details), 2.6 Å

PDB Description: Crystal structure of sTALL-1 and BCMA
PDB Compounds: (R:) Tumor necrosis factor receptor superfamily member 17

SCOPe Domain Sequences for d1oqdr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqdr_ g.24.1.2 (R:) Tumor necrosis factor receptor superfamily member 17, BCMA {Human (Homo sapiens) [TaxId: 9606]}
csqneyfdsllhacipcqlrcssntppltcqrycnasvt

SCOPe Domain Coordinates for d1oqdr_:

Click to download the PDB-style file with coordinates for d1oqdr_.
(The format of our PDB-style files is described here.)

Timeline for d1oqdr_: