Class g: Small proteins [56992] (100 folds) |
Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
Superfamily g.24.1: TNF receptor-like [57586] (3 families) |
Family g.24.1.2: BAFF receptor-like [90174] (4 proteins) only fragments of the receptor structures are available; no domain division is provided here |
Protein Tumor necrosis factor receptor superfamily member 17, BCMA [90177] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [90178] (3 PDB entries) Uniprot Q02223 8-43 |
Domain d1oqdm_: 1oqd M: [87280] Other proteins in same PDB: d1oqda_, d1oqdb_, d1oqdc_, d1oqdd_, d1oqde_, d1oqdf_, d1oqdg_, d1oqdh_, d1oqdi_, d1oqdj_ |
PDB Entry: 1oqd (more details), 2.6 Å
SCOPe Domain Sequences for d1oqdm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqdm_ g.24.1.2 (M:) Tumor necrosis factor receptor superfamily member 17, BCMA {Human (Homo sapiens) [TaxId: 9606]} csqneyfdsllhacipcqlrcssntppltcqrycnasvt
Timeline for d1oqdm_: