Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein Dihydropteridin reductase (pteridine reductase) [51769] (7 species) |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [89520] (1 PDB entry) |
Domain d1ooea_: 1ooe A: [87196] structural genomics complexed with mes |
PDB Entry: 1ooe (more details), 1.65 Å
SCOPe Domain Sequences for d1ooea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} ssgkvivyggkgalgsaileffkkngytvlnidlsandqadsnilvdgnknwteqeqsil eqtasslqgsqvdgvfcvaggwaggsasskdfvknadlmikqsvwssaiaaklatthlkp ggllqltgaaaamgptpsmigygmakaavhhltsslaakdsglpdnsavltimpvtldtp mnrkwmpnadhsswtplsfisehllkwttetssrpssgallkittengtstitpq
Timeline for d1ooea_: