Class a: All alpha proteins [46456] (226 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore |
Protein Phycocyanin alpha subunit [88933] (6 species) |
Species Synechococcus vulcanus [TaxId:32053] [88938] (3 PDB entries) |
Domain d1on7a_: 1on7 A: [87121] Other proteins in same PDB: d1on7b_ complexed with cyc |
PDB Entry: 1on7 (more details), 2.7 Å
SCOP Domain Sequences for d1on7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1on7a_ a.1.1.3 (A:) Phycocyanin alpha subunit {Synechococcus vulcanus} mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins tfdlspswyiealkyikanhgltgqaaveanayidyainals
Timeline for d1on7a_: