Lineage for d1on7a_ (1on7 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 531798Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 531823Protein Phycocyanin alpha subunit [88933] (6 species)
  7. 531860Species Synechococcus vulcanus [TaxId:32053] [88938] (3 PDB entries)
  8. 531863Domain d1on7a_: 1on7 A: [87121]
    Other proteins in same PDB: d1on7b_
    complexed with cyc

Details for d1on7a_

PDB Entry: 1on7 (more details), 2.7 Å

PDB Description: Unmethylated form of C-phycocyanin from Themosynechococcus vulcanus at 2.7A

SCOP Domain Sequences for d1on7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1on7a_ a.1.1.3 (A:) Phycocyanin alpha subunit {Synechococcus vulcanus}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

SCOP Domain Coordinates for d1on7a_:

Click to download the PDB-style file with coordinates for d1on7a_.
(The format of our PDB-style files is described here.)

Timeline for d1on7a_: