SCOP 1.69: Domain d1on7a_: 1on7 A:

Lineage for d1on7a_ (1on7 A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Phycocyanin alpha subunit [88933] (6 species)

7. Species Synechococcus vulcanus [TaxId:32053] [88938] (3 PDB entries)

8. Domain d1on7a_: 1on7 A: [87121]
   Other proteins in same PDB: d1on7b_

Details for d1on7a_

PDB Entry: 1on7, 2.7 Å

PDB Description: Unmethylated form of C-phycocyanin from Themosynechococcus vulcanus at 2.7A

SCOP Domain Sequences for d1on7a_:

Sequence; same for both SEQRES and ATOM records:

>d1on7a_ a.1.1.3 (A:) Phycocyanin alpha subunit {Synechococcus vulcanus}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

Timeline for d1on7a_:

• d1on7a_ first appeared in SCOP 1.65
  
• d1on7a_ appears in SCOP 1.67
  
• d1on7a_ appears in SCOP 1.71
  
• d1on7a_ appears in the current release, SCOPe 2.08