Lineage for d1omja1 (1omj A:245-463)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079406Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2079669Superfamily b.80.7: beta-Roll [51120] (2 families) (S)
    superhelix turns are made of two short strands each
  5. 2079670Family b.80.7.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein)
    duplication: halfturs of beta-helix are sequence and structural repeats; binds calcium ions between the turns
    this is a repeat family; one repeat unit is 1go7 P:374-356 found in domain
  6. 2079671Protein Metalloprotease [51122] (4 species)
    The catalytic N-terminal domain belong to the "zincin" superfamily
  7. 2079686Species Pseudomonas sp., tac ii 18 [TaxId:306] [82190] (8 PDB entries)
    psychrophilic alkaline protease
  8. 2079693Domain d1omja1: 1omj A:245-463 [87083]
    Other proteins in same PDB: d1omja2
    complexed with ca, so4, zn

Details for d1omja1

PDB Entry: 1omj (more details), 2.38 Å

PDB Description: crystal structure of a psychrophilic alkaline protease from pseudomonas tac ii 18
PDB Compounds: (A:) serralysin

SCOPe Domain Sequences for d1omja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1omja1 b.80.7.1 (A:245-463) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]}
anletraddtvygfnstadrdfysatsstdklifsvwdgggndtldfsgfsqnqkinlta
gsfsdvggmtgnvsiaqgvtienaiggsgndlligndaanvlkggagndiiyggggadvl
wggtgsdtfvfgavsdstpkaadiikdfqsgfdkidltaitklgglnfvdaftghagdai
vsyhqasnagslqvdfsgqgvadflvttvgqvatydiva

SCOPe Domain Coordinates for d1omja1:

Click to download the PDB-style file with coordinates for d1omja1.
(The format of our PDB-style files is described here.)

Timeline for d1omja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1omja2