Lineage for d1ohhb2 (1ohh B:24-94)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 955060Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 955061Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 955062Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 955063Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)
  7. 955066Species Cow (Bos taurus) [TaxId:9913] [88673] (14 PDB entries)
    Uniprot P19483
  8. 955104Domain d1ohhb2: 1ohh B:24-94 [87019]
    Other proteins in same PDB: d1ohha1, d1ohha3, d1ohhb1, d1ohhb3, d1ohhc1, d1ohhc3, d1ohhd1, d1ohhd2, d1ohhd3, d1ohhe1, d1ohhe2, d1ohhe3, d1ohhf1, d1ohhf2, d1ohhf3, d1ohhg_, d1ohhh_
    complexed with anp, mg

Details for d1ohhb2

PDB Entry: 1ohh (more details), 2.8 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the inhibitor protein if1
PDB Compounds: (B:) ATP synthase alpha chain heart isoform, mitochondrial

SCOPe Domain Sequences for d1ohhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohhb2 b.49.1.1 (B:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

SCOPe Domain Coordinates for d1ohhb2:

Click to download the PDB-style file with coordinates for d1ohhb2.
(The format of our PDB-style files is described here.)

Timeline for d1ohhb2: