Lineage for d1od9a_ (1od9 A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 364234Protein N-terminal domain of sialoadhesin [48732] (1 species)
  7. 364235Species Mouse (Mus musculus) [TaxId:10090] [48733] (5 PDB entries)
  8. 364239Domain d1od9a_: 1od9 A: [86839]
    complexed with bnd, so4

Details for d1od9a_

PDB Entry: 1od9 (more details), 2.1 Å

PDB Description: n-terminal of sialoadhesin in complex with me-a-9-n-benzoyl-amino-9- deoxy-neu5ac (benz compound)

SCOP Domain Sequences for d1od9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1od9a_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus)}
twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd

SCOP Domain Coordinates for d1od9a_:

Click to download the PDB-style file with coordinates for d1od9a_.
(The format of our PDB-style files is described here.)

Timeline for d1od9a_: