Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins) |
Protein Envelope glycoprotein [49213] (2 species) |
Species Dengue virus type 2 [TaxId:12637] [89194] (2 PDB entries) |
Domain d1oanb1: 1oan B:298-394 [86742] Other proteins in same PDB: d1oana2, d1oanb2 complexed with afl, bma, na, nag |
PDB Entry: 1oan (more details), 2.75 Å
SCOP Domain Sequences for d1oanb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oanb1 b.1.18.4 (B:298-394) Envelope glycoprotein {Dengue virus type 2} sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk
Timeline for d1oanb1: