Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins) barrel, closed; n=5, S=10 |
Protein Archaeal ssDNA-binding protein [89324] (1 species) similar to the domains of the Replication protein A |
Species Sulfolobus solfataricus [TaxId:2287] [89325] (1 PDB entry) |
Domain d1o7ib_: 1o7i B: [86643] complexed with so4 |
PDB Entry: 1o7i (more details), 1.2 Å
SCOPe Domain Sequences for d1o7ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o7ib_ b.40.4.3 (B:) Archaeal ssDNA-binding protein {Sulfolobus solfataricus [TaxId: 2287]} meekvgnlkpnmesvnvtvrvleasearqiqtkngvrtiseaivgdetgrvkltlwgkha gsikegqvvkienawttafkgqvqlnagsktkiaeasedgfpessqipentpta
Timeline for d1o7ib_: