Lineage for d1o3tb1 (1o3t B:138-205)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 277839Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) (S)
    contains a small beta-sheet (wing)
  5. 277875Family a.4.5.4: CAP C-terminal domain-like [46796] (3 proteins)
  6. 277876Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
    N-terminal domain has double beta-helix fold
  7. 277877Species Escherichia coli [TaxId:562] [46798] (14 PDB entries)
  8. 277900Domain d1o3tb1: 1o3t B:138-205 [86613]
    Other proteins in same PDB: d1o3ta2, d1o3tb2
    complexed with cmp

Details for d1o3tb1

PDB Entry: 1o3t (more details), 2.8 Å

PDB Description: protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes

SCOP Domain Sequences for d1o3tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o3tb1 a.4.5.4 (B:138-205) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivv

SCOP Domain Coordinates for d1o3tb1:

Click to download the PDB-style file with coordinates for d1o3tb1.
(The format of our PDB-style files is described here.)

Timeline for d1o3tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o3tb2