SCOP 1.65: Domain d1o3ta2: 1o3t A:9-137

Lineage for d1o3ta2 (1o3t A:9-137)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (3 proteins)

6. Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)

7. Species Escherichia coli [TaxId:562] [51212] (14 PDB entries)

8. Domain d1o3ta2: 1o3t A:9-137 [86612]
   Other proteins in same PDB: d1o3ta1, d1o3tb1

Details for d1o3ta2

PDB Entry: 1o3t, 2.8 Å

PDB Description: protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes

SCOP Domain Sequences for d1o3ta2:

Sequence; same for both SEQRES and ATOM records:

>d1o3ta2 b.82.3.2 (A:9-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli}
ptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqgd
figelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvts
ekvgnlafl

Timeline for d1o3ta2:

• d1o3ta2 is new in SCOP 1.65
  
• d1o3ta2 appears in SCOP 1.67
  
• d1o3ta2 appears in the current release, SCOPe 2.08