Lineage for d1o3qa1 (1o3q A:138-207)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1721480Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)
  6. 1721481Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
    N-terminal domain has double beta-helix fold
  7. 1721482Species Escherichia coli [TaxId:562] [46798] (26 PDB entries)
  8. 1721527Domain d1o3qa1: 1o3q A:138-207 [86605]
    Other proteins in same PDB: d1o3qa2
    protein/DNA complex; complexed with cmp

Details for d1o3qa1

PDB Entry: 1o3q (more details), 3 Å

PDB Description: protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
PDB Compounds: (A:) catabolite gene activator protein

SCOPe Domain Sequences for d1o3qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o3qa1 a.4.5.4 (A:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

SCOPe Domain Coordinates for d1o3qa1:

Click to download the PDB-style file with coordinates for d1o3qa1.
(The format of our PDB-style files is described here.)

Timeline for d1o3qa1: