Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) |
Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (5 proteins) Pfam PF03009 |
Protein Hypothetical protein TM1621 [89509] (1 species) |
Species Thermotoga maritima [TaxId:2336] [89510] (1 PDB entry) |
Domain d1o1za1: 1o1z A:2-222 [86555] Other proteins in same PDB: d1o1za2 structural genomics complexed with na |
PDB Entry: 1o1z (more details), 1.6 Å
SCOPe Domain Sequences for d1o1za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1za1 c.1.18.3 (A:2-222) Hypothetical protein TM1621 {Thermotoga maritima [TaxId: 2336]} ivlghrgysakylentleafmkaieagangveldvrlskdgkvvvshdedlkrlfgldvk irdatvselkeltdgkittlkevfenvsddkiinieikereaadavleiskkrknlifss fdldlldekfkgtkygylideenygsienfvervekerpyslhvpyqafeleyavevlrs frkkgivifvwtlndpeiyrkirreidgvitdevelfvklr
Timeline for d1o1za1: