Lineage for d1nykb_ (1nyk B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535669Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1535670Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1535671Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 1535738Protein Soluble Rieske protein [89291] (1 species)
  7. 1535739Species Thermus thermophilus [TaxId:274] [89292] (1 PDB entry)
  8. 1535741Domain d1nykb_: 1nyk B: [86409]
    complexed with fes, mg

Details for d1nykb_

PDB Entry: 1nyk (more details), 1.31 Å

PDB Description: Crystal Structure of the Rieske protein from Thermus thermophilus
PDB Compounds: (B:) Rieske iron-sulfur protein

SCOPe Domain Sequences for d1nykb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nykb_ b.33.1.1 (B:) Soluble Rieske protein {Thermus thermophilus [TaxId: 274]}
tpekeplkpgdilvyaqgggepkpirleelkpgdpfvlaypmdpktkvvksgeakntllv
arfdpeelapevaqhaaegvvaysavcthlgcivsqwvadeeaalcpchggvydlrhgaq
viagppprpvpqlpvrvedgvlvaageflgpvgvqa

SCOPe Domain Coordinates for d1nykb_:

Click to download the PDB-style file with coordinates for d1nykb_.
(The format of our PDB-style files is described here.)

Timeline for d1nykb_: