Class b: All beta proteins [48724] (176 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
Protein Soluble Rieske protein [89291] (1 species) |
Species Thermus thermophilus [TaxId:274] [89292] (1 PDB entry) |
Domain d1nykb_: 1nyk B: [86409] complexed with fes, mg |
PDB Entry: 1nyk (more details), 1.31 Å
SCOPe Domain Sequences for d1nykb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nykb_ b.33.1.1 (B:) Soluble Rieske protein {Thermus thermophilus [TaxId: 274]} tpekeplkpgdilvyaqgggepkpirleelkpgdpfvlaypmdpktkvvksgeakntllv arfdpeelapevaqhaaegvvaysavcthlgcivsqwvadeeaalcpchggvydlrhgaq viagppprpvpqlpvrvedgvlvaageflgpvgvqa
Timeline for d1nykb_: