SCOPe 2.08: Domain d1nykb_: 1nyk B:

Lineage for d1nykb_ (1nyk B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)

6. Protein Soluble Rieske protein [89291] (1 species)

7. Species Thermus thermophilus [TaxId:274] [89292] (1 PDB entry)

8. Domain d1nykb_: 1nyk B: [86409]
   complexed with fes, mg

Details for d1nykb_

PDB Entry: 1nyk, 1.31 Å

PDB Description: Crystal Structure of the Rieske protein from Thermus thermophilus

PDB Compounds: (B:) Rieske iron-sulfur protein

SCOPe Domain Sequences for d1nykb_:

Sequence; same for both SEQRES and ATOM records:

>d1nykb_ b.33.1.1 (B:) Soluble Rieske protein {Thermus thermophilus [TaxId: 274]}
tpekeplkpgdilvyaqgggepkpirleelkpgdpfvlaypmdpktkvvksgeakntllv
arfdpeelapevaqhaaegvvaysavcthlgcivsqwvadeeaalcpchggvydlrhgaq
viagppprpvpqlpvrvedgvlvaageflgpvgvqa

Timeline for d1nykb_:

• d1nykb_ first appeared in SCOP 1.65
  
• d1nykb_ appears in SCOPe 2.07